PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004073001
Common NameGSBRNA2T00004073001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 279aa    MW: 31386.1 Da    PI: 8.1801
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004073001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-3743101260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  GSBRNA2T00004073001  43 PQEPRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 101
                          67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.5E-3345101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.44447101IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-244899IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDHHHYTHHD HDQYQHHQMT ITNNNSYNTI ITTPPPRQQQ HRPQEPRNCP RCNSSNTKFC  60
YYNNYSLAQP RYLCKSCRRY WTEGGSLRNV PVGGGSRKNK KLPLLQPNSS SSSPAKNLPD  120
LNPPFAFTSS SSTSTSSNPS KSTHQNNNDL SLSFSYPTMQ ERAQGHYGHF MDQAMSGGQN  180
CLFSAPMGMI QFRQDYGHDH NKTDIGFSLD SNKVDSNNQN NFLVNGGGSK LMFPYGDRDE  240
HHHDHERHDD GNKKRESGSS NELWSGIILG GDSGGPTW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111400.11e-152PREDICTED: dof zinc finger protein DOF4.1
RefseqXP_009111401.11e-152PREDICTED: dof zinc finger protein DOF4.1
SwissprotQ9M1611e-126DOF41_ARATH; Dof zinc finger protein DOF4.1
TrEMBLA0A078IP670.0A0A078IP67_BRANA; BnaA09g52090D protein
STRINGBra037401.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.16e-99Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]